We believe this site might serve you best:

United States

United States

Language: English

Promega's Cookie Policy

Our website uses functional cookies that do not collect any personal information or track your browsing activity. When you select your country, you agree that we can place these functional cookies on your device.

CDK9/CyclinK Kinase Enzyme System

V4492

Easily Screen and Profile CDK9/CyclinK Kinase Inhibitors

  • Includes kinase, substrate and reaction buffer
  • Use with ADP-Glo™ Assay for bioluminescent detection of kinase activity

Size

Additional options

Catalog number selected: V4104

$ 435.00 Your price: Log in

CDK9/CyclinK Kinase Enzyme System
10µg
$ 435.00
Your price: Log in
Change Configuration
Kinase-background-v2light

Convenient, Scalable Kinase Profiling

The Kinase Enzyme Systems include a recombinant kinase enzyme, a substrate appropriate for the enzyme, a reaction buffer and supplemental reagents as needed. The CDK9/CyclinK Kinase Enzyme System contains:

  • CDK9/CyclinK Kinase, 10μg (Human, recombinant full-length). MW: ~68kDa (CDK9) and ~67kDa (CyclinK).
  • PDKtide ([protein fragment, 39 aa]) Substrate; residues 1–14 are derived from AKT1 (307–320), and residues 16–39 are derived from PKN2/PRK2 (961–984).
  • Reaction Buffer, DTT.

Recombinant full-length human CDK9 and CyclinK proteins were co-expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. CDK9/CyclinK is a member of the cyclin-dependent protein kinase (CDK) family. CDK9 is closely related to cdc28 and cdc2 and is an important regulator of the cell cycle. CDK9 is a component of the multiprotein complex TAK/P-TEFβ. CDK9 can modulate RNA polymerase II-directed transcription by phosphorylating the C-terminal domain of the largest subunit of RNA polymerase II. CDK9 forms a complex with and is regulated by its regulatory subunit cyclin T or cyclin K. CDK9 also interacts with the HIV-1 Tat protein, which suggests a possible involvement of this protein in AIDS.

CDK9/CyclinK NCBI Database Entry.

The CDK9/CyclinK Kinase Enzyme System can be purchased with or without the ADP-Glo™ Kinase Assay reagents. Used together, the ADP-Glo™ Kinase Assay + Kinase Enzyme Systems provide a convenient method for profiling the effect of lead compounds on kinase activity. Assay advantages include broad dynamic range, ease of use and high sensitivity. Kinase Enzyme Systems are manufactured by SignalChem. Bulk quantities available upon request.

Use with ADP-Glo™ Kinase Assay

The ADP-Glo™ Kinase Assay is a luminescent kinase assay that measures ADP formed from a kinase reaction; ADP is converted into ATP, which is a substrate in a reaction catalyzed by Ultra-Glo™ Luciferase that produces light. The luminescent signal positively correlates with ADP amount and kinase activity. The assay is well suited for measuring the effects of chemical compounds on the activity of a broad range of purified kinases, making it ideal for both primary screening as well as kinase selectivity profiling. The ADP-Glo™ Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g., kinase or ATPase) using up to 1mM ATP.

 

See all Kinase Enzyme Systems available from Promega.

Specifications

You are viewing: V4104 Change Configuration

SDS

Choose language:

Certificate of Analysis

Search for Specific Certificate:

View more results
No results
Loading…

Use Restrictions

For Research Use Only. Not for Use in Diagnostic Procedures.

Storage Conditions

AA

Specifications

You are viewing: V6283 Change Configuration

SDS

Choose language:

Certificate of Analysis

Search for Specific Certificate:

View more results
No results
Loading…

Use Restrictions

For Research Use Only. Not for Use in Diagnostic Procedures.

Storage Conditions

AA

Specifications

You are viewing: V4105 Change Configuration

What's in the box?

Item Part # Size
CDK9/CyclinK Kinase Enzyme System V4104 1 × 10μg

ADP-Glo™ Kinase Assay

V9101 1 × 1,000 assays

SDS

Choose language:

Certificate of Analysis

Search for Specific Certificate:

View more results
No results
Loading…

Use Restrictions

For Research Use Only. Not for Use in Diagnostic Procedures.

Storage Conditions

Patents and Disclaimers

U.S. Pat. Nos. 7,083,911, 7,452,663 and 7,732,128 and other patents.

U.S. Pat. No. 7,700,310 and other patents and patents pending.

U.S. Pat. Nos. 7,741,067, 8,361,739 and 8,603,767 and other patents and patents pending.

U.S. Pat. Nos. 6,602,677, 7,241,584, 8,030,017 and 8,822,170 and other patents and patents pending.

U.S. Pat. No. 8,183,007 and other patents and patents pending.

Licensed from Lonza Nottingham Ltd. under U.S. Pat. Nos. 6,599,711 and 6,911,319 and other pending and issued patents.

Choose your country

Americas

Brazil
Canada
United States

Pacific Asia

Australia
India
Japan
Korea, Republic of
Singapore

Europe

Austria
Belgium
Denmark
Estonia
Finland
France
Germany
Iceland
Italy
Luxembourg
Netherlands
Norway
Poland
Spain
Sweden
Switzerland
United Kingdom