Promega's Cookie Policy

We use cookies and similar technologies to make our website work, run analytics, improve our website, and show you personalized content and advertising. Some of these cookies are essential for our website to work. For others, we won’t set them unless you accept them. To find out more about cookies and how to manage cookies, read our Cookie Policy.

Our website does not fully support your browser.

We've detected that you are using an older version of Internet Explorer. Your commerce experience may be limited. Please update your browser to Internet Explorer 11 or above.

CDC7/DBF4 Kinase Enzyme System

Kinase Enzyme Systems for Detecting Kinase Activity

Easily Screen and Profile CDC7/DBF4 Kinase Inhibitors

  • Includes kinase, substrate and reaction buffer
  • Use with ADP-Glo™ Assay for bioluminescent detection of kinase activity


Additional options

Catalog number selected: V5088

$ 480.00
Your price:
Add to Cart
This product is discontinued
CDC7/DBF4 Kinase Enzyme System
$ 480.00
Your price: Log in
Change Configuration

Convenient, Scalable Kinase Profiling

The Kinase Enzyme Systems include a recombinant kinase enzyme, a substrate appropriate for the enzyme, a reaction buffer and supplemental reagents as needed. The CDC7/DBF4 Kinase Enzyme System contains:

  • CDC7/DBF4 Kinase, 10μg (Human, recombinant full-length). MW: ~94kDa (CDC7) and ~125kDa (DBF4).
  • PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) Substrate; derived from two human proteins: residues 1–14 are based on AKT1 (307–320), and residues 16–39 are based on PKN2/PRK2 (961–984).
  • Reaction Buffer, DTT.

Recombinant full-length human CDC7 and DBF4 proteins were co-expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. CDC7 is a cell division cycle 7 homolog protein that is critical for the G1/S transition and is also essential for initiation of DNA replication as cell division occurs. CDC7 is expressed in many normal tissues, but the overexpression of CDC7 may be associated with neoplastic transformation for some tumors and transformed cell lines. CDC7/DBF4 kinase promotes S phase by alleviating an inhibitory activity in Mcm4 that evolved to integrate several protein kinase.

CDC7/DBF4 NCBI Database Entry.

The CDC7/DBF4 Kinase Enzyme System can be purchased with or without the ADP-Glo™ Kinase Assay reagents. Used together, the ADP-Glo™ Kinase Assay + Kinase Enzyme Systems provide a convenient method for profiling the effect of lead compounds on kinase activity. Assay advantages include broad dynamic range, ease of use and high sensitivity. Kinase Enzyme Systems are manufactured by SignalChem. Bulk quantities available upon request.

Use with ADP-Glo™ Kinase Assay

The ADP-Glo™ Kinase Assay is a luminescent kinase assay that measures ADP formed from a kinase reaction; ADP is converted into ATP, which is a substrate in a reaction catalyzed by Ultra-Glo™ Luciferase that produces light. The luminescent signal positively correlates with ADP amount and kinase activity. The assay is well suited for measuring the effects of chemical compounds on the activity of a broad range of purified kinases, making it ideal for both primary screening as well as kinase selectivity profiling. The ADP-Glo™ Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g., kinase or ATPase) using up to 1mM ATP.


See all Kinase Enzyme Systems available from Promega.


You are viewing: V5088 Change Configuration


Choose language:

Download SDSPDF (257 KB) – English (United States)

Certificate of Analysis

Search by lot number

Use Restrictions

For Research Use Only. Not for Use in Diagnostic Procedures.

Storage Conditions



You are viewing: V6577 Change Configuration


Choose language:

Download SDSPDF (257 KB) – English (United States)

Certificate of Analysis

Search by lot number

Use Restrictions

For Research Use Only. Not for Use in Diagnostic Procedures.

Storage Conditions



You are viewing: V5089 Change Configuration

What's in the box?

Item Part # Size

CDC7/DBF4 Kinase Enzyme System

V5088 1 × 10μg

ADP-Glo™ Kinase Assay

V9101 1 × 1,000 assays


Choose language:

Download SDSPDF (439 KB) – English (United States)

Certificate of Analysis

Search by lot number

Use Restrictions

For Research Use Only. Not for Use in Diagnostic Procedures.

Storage Conditions

Patents and Disclaimers

European Pat. No. 1131441 and Japanese Pat. No. 4520084.

U.S. Pat. Nos. 7,083,911, 7,452,663 and 7,732,128 and other patents.

U.S. Pat. No. 7,700,310 and other patents and patents pending.

U.S. Pat. Nos. 7,741,067, 8,361,739 and 8,603,767 and other patents and patents pending.

U.S. Pat. No. 8,183,007 and other patents and patents pending.

Licensed from Lonza Nottingham Ltd. under U.S. Pat. Nos. 6,599,711 and 6,911,319 and other pending and issued patents.

Let's find the product that meets your needs.

Talk to a Scientist

