PDK1 Kinase Enzyme System

Kinase Enzyme Systems for Detecting Kinase Activity
View information on global supply logistics
customize-this-small

Easily Screen and Profile PDK1 Kinase Inhibitors

  • Includes kinase, substrate and reaction buffer
  • Use with ADP-Glo™ Assay for bioluminescent detection of kinase activity

Size

Additional options

Catalog number selected: V2761

$ 545.00
Your price:
Add to Cart
This product is discontinued
This product is available under our Early Access program - Learn More
This product is available under our Catalog (FT) program - Learn More
PDK1 Kinase Enzyme System
10µg
$ 545.00
Your price: Acceder
Cambiar Configuración

Convenient, Scalable Kinase Profiling

The Kinase Enzyme Systems include a recombinant kinase enzyme, a substrate appropriate for the enzyme, a reaction buffer and supplemental reagents as needed. The PDK1 Kinase Enzyme System contains:

  • PDK1 Kinase, 10μg (Human, recombinant full-length). MW: ~67kDa.
  • PDKtide ([protein fragment, 39 aa]) Substrate; derived from two human proteins: residues 1–14 are based on AKT1 (307–320) and residues 16–39 are based on PKN2/PRK2 (961–984).
  • Reaction Buffer, DTT.

Recombinant full-length human PDK1 was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag. PDK1 (3-phosphoinositide-dependent protein kinase) is activated by the presence of PtdIns(3,4,5)P3 or PtdIns(3,4)P2. PDK1 then activates protein kinase B (PKB), which in turn, inactivates glycogen synthase kinase-3 (GSK3). The phosphorylation of other proteins by PKB and GSK3 is likely to mediate many of the intracellular actions of insulin. Thus, PDK1 plays a key role in mediating many of the actions of the second messenger(s) PtdIns(3,4,5)P3 and/or PtdIns(3,4)P2. The human PDK1 is a 556-residue monomeric enzyme comprising of a catalytic domain that is most similar to the PKA, PKB and PKC subfamily of protein kinases.

PDK1 NCBI Database Entry.

The PDK1 Kinase Enzyme System can be purchased with or without the ADP-Glo™ Kinase Assay reagents. Used together, the ADP-Glo™ Kinase Assay + Kinase Enzyme Systems provide a convenient method for profiling the effect of lead compounds on kinase activity. Assay advantages include broad dynamic range, ease of use and high sensitivity. Kinase Enzyme Systems are manufactured by SignalChem. Bulk quantities available upon request.

Use with ADP-Glo™ Kinase Assay

The ADP-Glo™ Kinase Assay is a luminescent kinase assay that measures ADP formed from a kinase reaction; ADP is converted into ATP, which is a substrate in a reaction catalyzed by Ultra-Glo™ Luciferase that produces light. The luminescent signal positively correlates with ADP amount and kinase activity. The assay is well suited for measuring the effects of chemical compounds on the activity of a broad range of purified kinases, making it ideal for both primary screening as well as kinase selectivity profiling. The ADP-Glo™ Kinase Assay can be used to monitor the activity of virtually any ADP-generating enzyme (e.g., kinase or ATPase) using up to 1mM ATP.

 

See all Kinase Enzyme Systems available from Promega.

Especificaciones

You are viewing: V2761 Cambiar Configuración

Certificado de Análisis

Search by lot number

Use Restrictions

For Research Use Only. Not for Use in Diagnostic Procedures.

Condiciones de Almacenaje

AA

Especificaciones

You are viewing: V2762 Cambiar Configuración

Certificado de Análisis

Search by lot number

Use Restrictions

For Research Use Only. Not for Use in Diagnostic Procedures.

Condiciones de Almacenaje

AA

Especificaciones

You are viewing: V9681 Cambiar Configuración

Contenido

Item Part # Presentación

PDK1 Kinase Enzyme System

V2761 1 × 10μg

ADP-Glo™ Kinase Assay

V9101 1 × 1,000 assays

Certificado de Análisis

Search by lot number

Use Restrictions

For Research Use Only. Not for Use in Diagnostic Procedures.

Condiciones de Almacenaje

Patentes y Exclusiones

U.S. Pat. Nos. 7,741,067 and 8,361,739.

U.S. Pat. No. 7,700,310 and other patents and patents pending.

U.S. Pat. No. 8,183,007 and other patents and patents pending.

Encontremos el producto que se adapte a sus necesidades.

Hablar con un científico

scientist-uk-angus

Angus

UK